Home   |   Search   |   Browse   |   Software   |   Help   

Align your sequence(s)

inorganic pyrophospatase

class : all beta number of structures : 4 average size : 200 average PID : 39 %

PDB
code
start
residue
start
chain
end
residue
end
chain
name source resolution R-factor
2prd rasmol 1 - 174 - inorganic pyrophosphatase Thermus aquaticus 2.0 15.3
1obw rasmol 1 A 175 A inorganic pyrophosphatase Escherichia coli 1.9 17.6
1qez rasmol 1002 A 1171 A inorganic pyrophosphatase Sulfolobus acidocaldarius 2.7 19.7
1wgj rasmol 1 A 282 A inorganic pyrophosphatase Saccharomyces cerevisiae 2.0 17.2
pir | ali | malform | joy-html | colour postscript | postscript | superimposed coordinates (RasMol)

external links
PFAM : Pyrophosphatase  
other info key to JOY annotation | show related PDB structures

                           10        20        30        40        50  
2prd   (   1 )                             anlk-slpvgdkap-evVhMVIeVp
1obwa  (   1 )                              sll-nvpAGkdlp-edIyVVIeIp
1qeza  (1002 )                                  klspgknap-dvVnVLVeIp
1wgja  (   1 )    tyttrqigakNtleYkVYIekdgkPVSAFHDIpLyadkenniFnMVVEIp
                                                            bbbbbbb 

                           60        70        80        90        100 
2prd   (  24 )    rgs-gnKyeYdpd--lgaikld------rvLpg---aqfYPGDYGFIPsT
1obwa  (  23 )    anadpikyeIdke--sGalfvd------rfMst---amfYPCNyGyInhT
1qeza  (1021 )    qgs-nikyeydde--egvikvd------rvLyt---smnYpFNyGfIpgT
1wgja  (  51 )    rwt-naKLeItkeetLNPIiQdtkkgklrfVrnCfphhGYiHNYGAFPqT
                       bbbbb        bbbb      bb            bbbb    

                           110       120       130       140       150 
2prd   (  62 )    lae------------dgdpLdGLVlStypllpgvvveVrVVGLLlMedek
1obwa  (  62 )    lsl------------dgdpVdVLVptpyplqpgsvtrCrPVGVLkMtDea
1qeza  (1059 )    lEe------------dgdpLdVLViTnyqlypgsvieVrPIGILyMkdee
1wgja  ( 100 )    WEdpnvshpeTkavGdndPIDVLEIGetiAyTGqVKqVkALGIMALlDeg
                                      bbbb          bbbbbbbbbbbbbb  

                           160       170       180       190       200 
2prd   ( 100 )    ggdakVIGVva--edqrldhIqdigdVp---egvkqeIqhFFetYKalea
1obwa  ( 100 )    gedAKLVAVPhsklskeydhIkdvndLp---ellkaqIahFFehYkdlek
1qeza  (1097 )    gedAkIVAVPkdktdpsfsnikdIndLp---qatknkIvhFFehykelEp
1wgja  ( 150 )    eTDWKVIAIdi--ndplApkLndiedVekyfpgllraTneWFriYKiPd-
                  bb  bbbbbb       3     333     aaaaaaaaaaaaa      

                           210       220       230       240       250 
2prd   ( 145 )    kkgkwVkVt----gwrdrkaAleeVraCiarykg                
1obwa  ( 147 )    --gkwVkve----gwenaeaAkaeIvaSferaknk               
1qeza  (1144 )    --gkyVkIs----gwgsateAknrIqlAikrvs                 
1wgja  ( 197 )    --gkpeNqFafsGeAknkkyAldIIkethdsWkqLIagkssdskgIdltN
                       bbbb    bbb aaaaaaaaaaaaaaaa                 

                           260       270       280      
2prd                                                    
1obwa                                                   
1qeza                                                   
1wgja  ( 245 )    vtlpdtptyskaasdaippaslkadapidksidkwffi
                                                        


For comments or questions, please send us email. Copyright © 1997-2005 The HOMSTRAD authors