Home   |   Search   |   Browse   |   Software   |   Help   

Align your sequence(s)

CoA-dependent acetyltransferase

class : alpha beta number of structures : 4 average size : 232 average PID : 25 %

PDB
code
start
residue
start
chain
end
residue
end
chain
name source resolution R-factor
3cla rasmol 6 - 219 - chloramphenicol acetyltransferase iii Escherichia coli 1.75 15.7
1e2o rasmol 172 - 404 - dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex [domain swapped for 172-197] Escherichia coli 3.0 20.5
1eaf rasmol 395 - 637 - dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex [domain swapped for 395-431] Azotobacter vinelandii 2.3 19.8
1b5s rasmol 184 A 425 A dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex Bacillus stearothermophilus 4.4 N/A
pir | ali | malform | joy-html | colour postscript | postscript | superimposed coordinates (RasMol)

external links
PFAM : CAT  2-oxoacid_dh  
other info key to JOY annotation | show related PDB structures

                           10        20        30        40        50  
3cla   (   6 )                mnytkfdvknwvrrehfefyrhr--l-pcgfslTskId
1e2o   ( 172 )               arsekrvpmt-rlrkrvaerlleakns tamlttfneVn
1eaf   ( 395 )    ippippvdfakygeieevpMt-rlmqigatnlhrswln VPhvtqfesAd
1b5sa  ( 184 )    aaakpattegefpetre-kms-girraiakamvhskht-aphvtlmdead
                                        aaaaaaaaaaaaa      bbbbbbbbb

                           60        70        80        90        100 
3cla   (  41 )    IttLkksldds----------aykfypVMIYLIAqAVnqfdeLRMaikd-
1e2o   ( 209 )    MkpImdlrkqygeafekrhgirLgfmSFYVkAVVeALkrypeVNAsid--
1eaf   ( 443 )    IteLeafrvaqkavAkk-agvkLtvlPLLLkACAyLLkelpdFNSSlaps
1b5sa  ( 231 )    vtklvahrkkfkaiaae-kgikltflpyvvkalvsalreypvlntsidde
                   aaaaaaaaa aaaaaa        aaaaaaaaaaaaaa 333 bbb   

                           110       120       130       140       150 
3cla   (  81 )    -deLIvWdsVdPQFtvfHqetetfSALsCpyss--dIdqFmvnylsVmer
1e2o   ( 257 )    gddvvyhnyfdVSMavst    glvtPVLrdVdtlgmadIekkikelavk
1eaf   ( 492 )    gqalirKkyVHIGfavdTpd--gllvPVIrnVdqksllqLAaeaaelaek
1b5sa  ( 280 )    teeiiqkhyyniGiaadtdr--gllvpvikhadrkpifalaqeinelaek
                    bbbb     bbb bb      bb  bb       aaaaaaaaaaaaaa

                           160       170       180       190       200 
3cla   ( 128 )    yks-dtklfPqgvtpenhLNIsalpwvnfdsfnlnvanftdyFaPiITMA
1e2o   ( 305 )    G-dgkltvedlt---gGNFTItnggvfgslmstpiI--nppQS-AiLGMH
1eaf   ( 540 )    ArskkLgadamq---gaCFTIsslghiggtaftpiV--napEV-AiLGVS
1b5sa  ( 328 )    Ardgkltpgemk---gasctitnigsaggqwftpvi--nhpev-ailgig
                  a                 bbbbb                     bbbbb 

                           210       220       230       240       250 
3cla   ( 177 )    kyqqeg--------drllLPLSVqVHhAVCdgfhVarFinrLqelCnskL
1e2o   ( 349 )    aikdrpmavngqveilpMMyLALSYDhrlIdgreSvgFLvTIkeLLedpt
1eaf   ( 584 )    kasmqpvwdgkafqprlmLpLSLSYDhrVIngaaAarFTkrLgdLLadir
1b5sa  ( 372 )    riaekpivrdgeivaapmlalslsfdhrmidgataqkalnhikrllsdpe
                    bbbbbb    bbbbbbbbbbbbbb     aaaaaaaaaaaaaaaa   

                        
3cla   ( 219 )    k     
1e2o   ( 399 )    rllldv
1eaf   ( 634 )    aill  
1b5sa  ( 422 )    lllm  
                        


For comments or questions, please send us email. Copyright © 1997-2005 The HOMSTRAD authors