Home   |   Search   |   Browse   |   Software   |   Help   

Align your sequence(s)

Helix-loop-helix DNA-binding domain

class : all alpha number of structures : 5 average size : 71 average PID : 28 %

PDB
code
start
residue
start
chain
end
residue
end
chain
name source resolution R-factor
1mdy rasmol 1 A 166 A myoblast determination protein 1 Mus musculus 2.80 25.3
1an4 rasmol 196 A 260 A upstream stimulatory factor 1 Homo sapiens 2.90 23.6
1hlo rasmol 3 A 82 A transcription factor max Homo sapiens 2.80 21.3
1am9 rasmol 319 A 398 A sterol regulatory element binding protein 1 Homo sapiens 2.30 21.9
1a0a rasmol 0 A 62 A phosphate system positive regulatory protein pho4 Saccharomyces cerevisiae 2.80 23.0
pir | ali | malform | joy-html | colour postscript | postscript | superimposed coordinates (RasMol)

external links
PFAM : HLH  
other info key to JOY annotation | show related PDB structures

                           10        20        30        40        50  
1mdya  (   1 )    melkrkttnadrrkaatmrerrrlskvneafetlkrstssnp----nqrl
1an4a  ( 196 )           mdekrraqhneverrrrdkinnwivqlskiIpDssmestksgq
1hloa  (   3 )    nddievesdadkrahhnalerkrrdhikdsfhslrdsVpslq----gekA
1am9a  ( 319 )          qsrgekrtahnaiekryrssindkiielkdlV-vgt----eakl
1a0aa  (   0 )              mkreshkhaeqarrnrlavalhelaslipaewkqqnvsaa
                                  aaaaaaaaaaaaaaaaaaaa              

                           60        70        80        90  
1mdya  ( 145 )    -pkveIlrnairyieglqallrd                   
1an4a  ( 239 )    -skggIlskasdyiqelrqsnhr                   
1hloa  (  49 )    -sraqIldkateyiqymrrknhthqqdiddlkrqn       
1am9a  ( 358 )    -nksaVlrkaidyirflqhsnqklkqenlslrtavhkskslk
1a0aa  (  40 )    pskattveaacryirhlqqngst                   
                      aaaaaaaaaaaaaa                        


For comments or questions, please send us email. Copyright © 1997-2005 The HOMSTRAD authors