Home   |   Search   |   Browse   |   Software   |   Help   

Align your sequence(s)

G protein gamma subunit-like motifs

class : all alpha number of structures : 2 average size : 61 average PID : 35 %

PDB
code
start
residue
start
chain
end
residue
end
chain
name source resolution R-factor
1tbg rasmol 501 E 568 E guanine nucleotide-binding protein G(t) gamma-1 subunit (transducin gamma chain) Bos taurus 2.1 20
1gp2 rasmol 8 G 61 G guanine nucleotide-binding protein G(i)/G(s)/G(o) gamma-2 subunit (G gamma-i) Bos taurus 2.3 22.6
pir | ali | malform | joy-html | colour postscript | postscript | superimposed coordinates (RasMol)

external links
SMART : GGL  
PFAM : G-gamma  
other info key to JOY annotation | show related PDB structures

                           10        20        30        40        50  
1tbge  ( 501 )    apviniedltekdklkmevdqlkkevtlermlvskcceefrdyveersge
1gp2g  (   8 )              siaqarklveqlkmeanidrikvskaaadlmayceahake
                              aaaaaaaaaaaaaa      aaaaaaaaaaaaa     

                           60       
1tbge  ( 551 )    dplvkgipedknpfkelk
1gp2g  (  48 )    dplltpvpasenpf    
                                    


For comments or questions, please send us email. Copyright © 1997-2005 The HOMSTRAD authors