Home   |   Search   |   Browse   |   Software   |   Help   

Align your sequence(s)

Bacterial DNA-binding protein

class : all alpha number of structures : 4 average size : 90 average PID : 33 %

PDB
code
start
residue
start
chain
end
residue
end
chain
name source resolution R-factor
1huu rasmol 1 C 90 C DNA-binding protein HU Bacillus stearothermophilus 2.00 19.3
1wtu rasmol 1 A 99 A transcription factor 1 Bacteriophage sp01 N/A N/A
1ihf rasmol 2 A 97 A integration host factor alpha-subunit Escherichia coli 2.50 19.2
1ihf rasmol 1 B 94 B integration host factor beta-subunit Escherichia coli 2.50 19.2
pir | ali | malform | joy-html | colour postscript | postscript | superimposed coordinates (RasMol)

external links
PFAM : Bac_DNA_binding  
other info key to JOY annotation | show related PDB structures

                            10        20        30        40        50  
1huuc1  (   1 )     mnktelinavaetsg-lskkdAtkaVdavfdsitealrkgdkvqligfG
1wtua   (   1 )     mnktelikaiaqdte-ltqvsVskmlasfekittetvakgdkvqltgfl
1ihfa   (   2 )    altkaemseylfdklg-lskrdAkelVelffeeirralengeqvklsgfg
1ihfb   (   1 )     mtkselierlatqqshipaktvedaVkemlehmastlaqgerieirgfg
                      aaaaaaaaaaa     aaaaaaaaaaaaaaaaaaaa    bbb   b

                            60        70        80        90        100 
1huuc1  (  49 )    nfevre-------------------rkvpafkpgkalkdavk        
1wtua   (  49 )    nIkpvarqarkgfnpqtqealeiApsvgvsvkpgeslkkaaeglkyedfa
1ihfa   (  51 )    nfdlrdknqrpgrnpktgedipitarrvvtfrpgqklksrvenaspk   
1ihfb   (  50 )    sfslhyraprtGrnpktgdkvelegkyvphfkpgkelrdraniyg     
                   bbbbb                      bbbbbb aaaaaaa         

                    
1huuc1              
1wtua   (  99 )    k
1ihfa               
1ihfb               
                    


For comments or questions, please send us email. Copyright © 1997-2005 The HOMSTRAD authors